PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11747_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 319aa    MW: 34486.3 Da    PI: 9.1856
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11747_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.7e-4124100278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     C v+gC adl+++++yhrrhkvCe hsk+p+v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Neem_11747_f_2  24 CLVDGCVADLAKCRDYHRRHKVCELHSKTPKVTIQGHEQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKPQP 100
                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.4E-341685IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.8642198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-3822103IPR004333Transcription factor, SBP-box
PfamPF031107.9E-302497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MESSASSSSK RARAPSNGNQ VPSCLVDGCV ADLAKCRDYH RRHKVCELHS KTPKVTIQGH  60
EQRFCQQCSR FHSLVEFDEG KRSCRKRLDG HNRRRRKPQP DSLSINSGRF FPEHQGTKFI  120
PFGSPQVFPA GAVTTALAGI VKAKTDIMLH NYHSQIDFSN RNLFLGSSSD NYKGGKQFPF  180
LEGGTNSTLH GASVCQPLLG ANTSVGNRGS SQKIFCSGLN SVVNSSRALS LLSSPQSETG  240
EIGFSHMVQT DHSIPAAQSL IPSLNYSGLG MNGEPIGSNL VTDSSSTANF HGHGQDTFQI  300
GADGSSRTGT HQTLSFSWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2824971184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18097KRSCRKRLDGHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437993.11e-142hypothetical protein CICLE_v10032171mg
RefseqXP_006484147.11e-142PREDICTED: teosinte glume architecture 1-like
RefseqXP_006484148.11e-142PREDICTED: teosinte glume architecture 1-like
RefseqXP_006484149.11e-142PREDICTED: teosinte glume architecture 1-like
SwissprotQ6YZE82e-65SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLA0A067GT511e-143A0A067GT51_CITSI; Uncharacterized protein
STRINGPOPTR_0001s13630.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-52SBP family protein